PlantTFDB
Plant Transcription Factor Database
v4.0
Previous version: v3.0
Transcription Factor Information
Basic Information | Signature Domain | Sequence | 
Basic Information? help Back to Top
TF ID Glyma.01G240100.1.p
Common NameGLYMA_01G240100, LOC100815499
Organism
Taxonomic ID
Taxonomic Lineage
cellular organisms; Eukaryota; Viridiplantae; Streptophyta; Streptophytina; Embryophyta; Tracheophyta; Euphyllophyta; Spermatophyta; Magnoliophyta; Mesangiospermae; eudicotyledons; Gunneridae; Pentapetalae; rosids; fabids; Fabales; Fabaceae; Papilionoideae; Phaseoleae; Glycine; Soja
Family HD-ZIP
Protein Properties Length: 732aa    MW: 80340 Da    PI: 6.2778
Description HD-ZIP family protein
Gene Model
Gene Model ID Type Source Coding Sequence
Glyma.01G240100.1.pgenomeJGIView CDS
Signature Domain? help Back to Top
Signature Domain
No. Domain Score E-value Start End HMM Start HMM End
1Homeobox62.46.7e-2063118156
                          TT--SS--HHHHHHHHHHHHHSSS--HHHHHHHHHHCTS-HHHHHHHHHHHHHHHH CS
             Homeobox   1 rrkRttftkeqleeLeelFeknrypsaeereeLAkklgLterqVkvWFqNrRakek 56 
                          ++  +++t+ q+ee+e++F+++++p+ ++r+eL+++lgL+  qVk+WFqN+R+++k
  Glyma.01G240100.1.p  63 KKGYRRHTQRQIEEMEAFFKQCPHPDDKQRKELSRELGLEPLQVKFWFQNKRTQMK 118
                          5778899**********************************************999 PP

2START206.78.9e-652504701206
                          HHHHHHHHHHHHHHHHC-TT-EEEE...EXCCTTEEEEEEESSS.......SCEEEEEEEECCSCHHHHHHHHHCCCGGCT-TT-S.... CS
                START   1 elaeeaaqelvkkalaeepgWvkss...esengdevlqkfeeskv......dsgealrasgvvdmvlallveellddkeqWdetla.... 77 
                          ela +a++el ++a+a+ep+Wv s    e++n+de+l++f++ +        ++ea+r+s+vv+m++ +l  +l+d++ qW++ +     
  Glyma.01G240100.1.p 250 ELAVAAMEELTRLAQAGEPLWVPSNhhsEILNEDEYLRTFPTRGLgpkplgLRSEASRESVVVIMNHINLIDILMDVN-QWSTVFCgivs 338
                          57899***********************************88766*********************************.******99999 PP

                          EEEEEEEECTT......EEEEEEEEXXTTXX-SSX.EEEEEEEEEEE.TTS-EEEEEEEEE-TTS--.-TTSEE-EESSEEEEEEEECTC CS
                START  78 kaetlevissg......galqlmvaelqalsplvp.RdfvfvRyirqlgagdwvivdvSvdseqkppesssvvRaellpSgiliepksng 160
                          +a tlev+s+g      galq+m++e+q+ splvp R+ +fvRy++q+++g w++vdvS+d+ ++ +    + R++++pSg+li++++ng
  Glyma.01G240100.1.p 339 RALTLEVLSTGiagnynGALQVMSSEFQVASPLVPtRENYFVRYCKQQPDGIWAVVDVSLDNLRPST----ISRSRRRPSGCLIQELPNG 424
                          *****************************************************************88....79***************** PP

                          EEEEEEEE-EE--SSXXHHHHHHHHHHHHHHHHHHHHHHTXXXXXX CS
                START 161 hskvtwvehvdlkgrlphwllrslvksglaegaktwvatlqrqcek 206
                          +skvtw+ehv++++r +h+++r lv+sgla+gak+wvatl+rqce+
  Glyma.01G240100.1.p 425 YSKVTWIEHVEVDDRAVHSIYRTLVNSGLAFGAKRWVATLERQCER 470
                          ********************************************97 PP

Protein Features ? help Back to Top
3D Structure
Database Entry ID E-value Start End InterPro ID Description
SuperFamilySSF466895.85E-1947120IPR009057Homeodomain-like
Gene3DG3DSA:1.10.10.601.6E-2148118IPR009057Homeodomain-like
PROSITE profilePS5007116.68260120IPR001356Homeobox domain
SMARTSM003891.8E-1862124IPR001356Homeobox domain
PfamPF000462.0E-1763118IPR001356Homeobox domain
CDDcd000862.78E-1863121No hitNo description
PROSITE patternPS00027095118IPR017970Homeobox, conserved site
PROSITE profilePS5084846.166241473IPR002913START domain
SuperFamilySSF559613.71E-36242472No hitNo description
CDDcd088752.14E-122245469No hitNo description
SMARTSM002343.3E-66250470IPR002913START domain
PfamPF018522.5E-54251470IPR002913START domain
Gene3DG3DSA:3.30.530.201.3E-6352470IPR023393START-like domain
SuperFamilySSF559619.16E-24491721No hitNo description
Gene Ontology ? help Back to Top
GO Term GO Category GO Description
GO:0006355Biological Processregulation of transcription, DNA-templated
GO:0005634Cellular Componentnucleus
GO:0008289Molecular Functionlipid binding
GO:0043565Molecular Functionsequence-specific DNA binding
Sequence ? help Back to Top
Protein Sequence    Length: 732 aa     Download sequence    Send to blast
MFDTNMFDSH PHLLDMSPPH KTTCSESDLA KPCRDDEYET KSITDTMDAP SGDDQDPNPR  60
PKKKGYRRHT QRQIEEMEAF FKQCPHPDDK QRKELSRELG LEPLQVKFWF QNKRTQMKTQ  120
HERNENAILK AENEKLRAEN SRYKEALTNA TCPNCGGPAA LGEMSFDEQH LRIENARLRE  180
EIDRISGIAA KYVGKPVTSS YSNLSSLNNN HVPVGNYGSQ SGTVGEMYGG SDLFRPLPAP  240
ADADKPMIVE LAVAAMEELT RLAQAGEPLW VPSNHHSEIL NEDEYLRTFP TRGLGPKPLG  300
LRSEASRESV VVIMNHINLI DILMDVNQWS TVFCGIVSRA LTLEVLSTGI AGNYNGALQV  360
MSSEFQVASP LVPTRENYFV RYCKQQPDGI WAVVDVSLDN LRPSTISRSR RRPSGCLIQE  420
LPNGYSKVTW IEHVEVDDRA VHSIYRTLVN SGLAFGAKRW VATLERQCER LASSMANNIP  480
AGDLCVITSA EGRKSMMKLA ERMVMSYCTG VGASTAHAWT TLSATGCDDV RVMTRKSTDE  540
PGRPPGIVLS AATSFWLPVP PKRVFHFLRD QNSRNEWDIL SNGGLVQELA HIANGRDPGN  600
CVSLLRVNSA NSSQSNMLIL QESCTDSTGS YVVYAPVDIV AMNVVLSGGD PDYVALLPSG  660
FAILPDGPPA LNGGPIHDVG SGGSLLTVAF QILVDSAPTA KLSLGSVATV NSLIKCTVER  720
IKVAVIRDNT T*
Expression -- UniGene ? help Back to Top
UniGene ID E-value Expressed in
Gma.446820.0hypocotyl
Regulation -- PlantRegMap ? help Back to Top
Source Upstream Regulator Target Gene
PlantRegMapRetrieve-
Annotation -- Nucleotide ? help Back to Top
Source Hit ID E-value Description
GenBankAP0150431e-143AP015043.1 Vigna angularis var. angularis DNA, chromosome 10, almost complete sequence, cultivar: Shumari.
Annotation -- Protein ? help Back to Top
Source Hit ID E-value Description
RefseqXP_003517589.10.0PREDICTED: homeobox-leucine zipper protein MERISTEM L1-like isoform X1
RefseqXP_014632955.10.0PREDICTED: homeobox-leucine zipper protein MERISTEM L1-like isoform X1
SwissprotQ8RWU40.0ATML1_ARATH; Homeobox-leucine zipper protein MERISTEM L1
TrEMBLI1JAV70.0I1JAV7_SOYBN; Uncharacterized protein
STRINGGLYMA01G45070.20.0(Glycine max)
Orthologous Group ? help Back to Top
LineageOrthologous Group IDTaxa NumberGene Number
FabidsOGEF15083499
Representative plantOGRP14515136
Best hit in Arabidopsis thaliana ? help Back to Top
Hit ID E-value Description
AT4G21750.20.0HD-ZIP family protein